Rabbit Polyclonal ECSIT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ECSIT antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human ECSIT. |
Rabbit Polyclonal ECSIT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ECSIT antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human ECSIT. |
Rabbit polyclonal ECSIT Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ECSIT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-425 amino acids from the C-terminal region of human ECSIT. |
Rabbit Polyclonal Anti-Ecsit Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SITPEC antibody: synthetic peptide directed towards the middle region of mouse SITPEC. Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP |