Mouse Monoclonal D4-GDI/RhoGDI2 (cleavage specific) Antibody (97A1015)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal D4-GDI/RhoGDI2 (cleavage specific) Antibody (97A1015)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal D4-GDI/RhoGDI2 Antibody (10D774)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-ARHGDIB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TEKAPEPHVE-C, from the N Terminus of the protein sequence according to NP_001166.3. |
Rabbit Polyclonal Anti-ARHGDIB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARHGDIB antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGDIB. Synthetic peptide located within the following region: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKK |