Antibodies

Jump to Filters
View as table Download
D4 (ARHGDIB) Mouse Monoclonal Antibody [Clone ID: 97A1015]
TA336465

USD 424.00

5 Days

Mouse Monoclonal D4-GDI/RhoGDI2 (cleavage specific) Antibody (97A1015)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
D4 (ARHGDIB) Mouse Monoclonal Antibody [Clone ID: 10D774]
TA336402

USD 424.00

5 Days

Mouse Monoclonal D4-GDI/RhoGDI2 Antibody (10D774)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
D4 (ARHGDIB) Goat Polyclonal Antibody
TA311200

USD 375.00

5 Days

Goat Anti-ARHGDIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TEKAPEPHVE-C, from the N Terminus of the protein sequence according to NP_001166.3.
D4 (ARHGDIB) Rabbit Polyclonal Antibody
TA343165

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARHGDIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGDIB antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGDIB. Synthetic peptide located within the following region: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKK