Antibodies

View as table Download

Rabbit Polyclonal Anti-ME2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ME2 antibody was raised against a 17 amino acid peptide near the center of human ME2.

Rabbit Polyclonal Anti-ME1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ME1 antibody was raised against a 16 amino acid peptide near the amino terminus of human ME1.

Rabbit polyclonal antibody to ME1 (malic enzyme 1, NADP(+)-dependent, cytosolic)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 161 and 519 of (Uniprot ID#P48163)

Rabbit polyclonal anti-ME1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ME1.

Rabbit Polyclonal Anti-ME1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ME1 antibody: synthetic peptide directed towards the N terminal of human ME1. Synthetic peptide located within the following region: QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL

Rabbit Polyclonal Anti-ME1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ME1 antibody is: synthetic peptide directed towards the C-terminal region of Human ME1. Synthetic peptide located within the following region: KAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGV

Rabbit Polyclonal Anti-ME1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ME1