Rabbit Polyclonal HIF-2 alpha Antibody
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Rabbit Polyclonal HIF-2 alpha Antibody
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Mouse Monoclonal Antibody against HIF-2 alpha (ep190b)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EPAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD |
Mouse monoclonal Anti-HIF2A Clone Hif2a 237
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-HIF2A Clone EP190b
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |