Rabbit Polyclonal HOXA3 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal HOXA3 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-HOXA3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the C terminal of human HOXA3. Synthetic peptide located within the following region: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPAC |
Rabbit Polyclonal Anti-HOXA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the middle region of human HOXA3. Synthetic peptide located within the following region: PPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHIQGSPVFVGGSYVE |
Carrier-free (BSA/glycerol-free) HOXA3 mouse monoclonal antibody,clone OTI8C5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HOXA3 mouse monoclonal antibody,clone OTI1A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HOXA3 mouse monoclonal antibody,clone OTI1C8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXA3 |
HOXA3 mouse monoclonal antibody,clone OTI8C5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXA3 mouse monoclonal antibody,clone OTI8C5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXA3 mouse monoclonal antibody,clone OTI1A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXA3 mouse monoclonal antibody,clone OTI1A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXA3 mouse monoclonal antibody,clone OTI1C8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXA3 mouse monoclonal antibody,clone OTI1C8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |