Rabbit Polyclonal Anti-TAU Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TAU antibody was raised against a 19 amino acid peptide near the amino terminus of human TAU. |
Rabbit Polyclonal Anti-TAU Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TAU antibody was raised against a 19 amino acid peptide near the amino terminus of human TAU. |
Rabbit Polyclonal Anti-MAGEA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAGEA4 antibody: synthetic peptide directed towards the C terminal of human MAGEA4. Synthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP |
Carrier-free (BSA/glycerol-free) MAGEA4 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAGEA4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAGEA4 mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-MAGEA4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-MAGEA4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
MAGEA4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-317 of human MAGEA4 (NP_002353.3). |
Modifications | Unmodified |
MAGEA4 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAGEA4 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAGEA4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAGEA4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAGEA4 mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAGEA4 mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAGEA4 mouse monoclonal antibody, clone OTI1F9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
2 Weeks
MAGEA4 biotinylated mouse monoclonal antibody, clone OTI5E8
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |