Rabbit Polyclonal TNFAIP3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TNFAIP3 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human TNFAIP3. |
Rabbit Polyclonal TNFAIP3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TNFAIP3 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human TNFAIP3. |
TNFAIP3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFAIP3 |
Rabbit Polyclonal TNFAIP3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TNFAIP3 antibody was raised against a 17 amino acid peptide near the center of human TNFAIP3. |
Rabbit polyclonal anti-TNAP3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNAP3. |
Mouse Monoclonal A20/TNFAIP3 Antibody (59A426)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TNFAIP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFAIP3 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFAIP3. Synthetic peptide located within the following region: QENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHE |
TNFAIP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFAIP3 |
TNFAIP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFAIP3 |
TNFAIP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFAIP3 |
TNFAIP3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TNFAIP3 (NP_006281.1). |
Modifications | Unmodified |
TNFAIP3 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human TNFAIP3 |
TNFAIP3 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |