Antibodies

View as table Download

Rabbit Polyclonal UBC13 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UBC13 antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of human UBC13.

Rabbit Polyclonal Anti-UBE2N Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBE2N Antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE

Rabbit Polyclonal Anti-UBE2N Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW

Goat polyclonal anti-UBC13 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 40-51 of human UBC13 protein.

UBE2N rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBE2N

Ube2N/Ubc13 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human Ube2N/Ubc13 (NP_003339.1).
Modifications Unmodified