Rabbit Polyclonal Anti-ARIH2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Arih2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Arih2. Synthetic peptide located within the following region: YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ |
Goat Anti-ARIH2 / TRIAD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQRRRTLLKDFHDT, from the C Terminus of the protein sequence according to NP_006312.1. |
Carrier-free (BSA/glycerol-free) ARIH2 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARIH2 mouse monoclonal antibody,clone OTI7D5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified ARIH2 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified ARIH2 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARIH2 mouse monoclonal antibody,clone OTI7D5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ARIH2 mouse monoclonal antibody,clone OTI7D5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARIH2 mouse monoclonal antibody,clone OTI1B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
