Antibodies

View as table Download

Mouse IL-33 Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the center of human IL-33.

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the amino terminus of human IL-33.

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC

Rabbit polyclonal IL-33 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.

Rabbit polyclonal anti-IL-33 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.

Rabbit polyclonal IL-33 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.

Anti-Human IL-33 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-33

Mouse Monoclonal IL-33 Antibody (6H496)

Applications WB
Reactivities Human
Conjugation Unconjugated

IL33 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL33

IL33 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IL33

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33

IL33 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 95-270 of human IL33 (NP_254274.1).
Modifications Unmodified