Antibodies

View as table Download

Rabbit polyclonal anti-DCC antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCC.

Rabbit Polyclonal Anti-DCC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCC antibody: synthetic peptide directed towards the middle region of human DCC. Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ

Rabbit anti DCC Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus (within 1380-1447aa) of Human DCC protein.

Carrier-free (BSA/glycerol-free) DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-DCC Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DCC

DCC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human DCC
Modifications Unmodified

DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated