Rabbit Polyclonal Anti-TIM3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TIM3 antibody was raised against a peptide corresponding to 16 amino acids near the amino terminus of human TIM3. The immunogen is located within amino acids 60 - 110 of TIM3. |
Goat Polyclonal Antibody against TIM3 / HAVCR2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KWYSHSKEKIQN, from the internal region of the protein sequence according to NP_116171.3. |
Rabbit polyclonal anti-Tim-3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid residue 285 of human Tim-3 |
Rat Anti-Mouse TIM3 Purified (50 ug)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rat Anti-Mouse TIM3 Purified (50 ug)
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal TIM-3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 100-200 of mouse TIM-3 protein were used as the immunogen. |
Rabbit Polyclonal Anti-HAVCR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAVCR2 antibody: synthetic peptide directed towards the N terminal of human HAVCR2. Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP |
HAVCR2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HAVCR2 |
TIM-3/HAVCR2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIM-3/HAVCR2 (NP_116171.3). |
| Modifications | Unmodified |
TIM-3/HAVCR2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human TIM-3/HAVCR2 (NP_116171.3). |
| Modifications | Unmodified |
TIM-3/HAVCR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human TIM-3/HAVCR2 (NP_116171.3). |
HAVCR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of Mouse HAVCR2. |
| Modifications | Unmodified |
Recombinant Anti-Tim-3 (Clone 2C12)
| Applications | Bl, FC, IF, IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-Tim-3 (Clone 2C12)
| Applications | Bl, FC, IF, IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
HAVCR2 mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HAVCR2 mouse monoclonal antibody,clone OTI12C5
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HAVCR2 mouse monoclonal antibody,clone OTI6E5
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HAVCR2 mouse monoclonal antibody,clone OTI1D6
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
