Rabbit Polyclonal Anti-MPO Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MPO |
Rabbit Polyclonal Anti-MPO Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MPO |
Rabbit Polyclonal Anti-MPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR |
Rabbit polyclonal anti-Myeloperoxidase (MPO) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 765 of human MPO |
Rabbit polyclonal Myeloperoxidase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Myeloperoxidase [Human Leukocytes] |
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI3A11
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI3E7
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2A11
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI3E10
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI1D3
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI4G10
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI6A9
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2E1C7
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI4B7
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI5G2
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI5H2
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI11C7
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2G4
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2G3
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2E1E1
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2E12
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2F3
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI7A1
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI8E8
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI5G5
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI8F12
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI1B5
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI2F2
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI4D4
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI1C6
Carrier-free (BSA/glycerol-free) MPO mouse monoclonal antibody, clone OTI4B1
Rabbit Polyclonal Myeloperoxidase Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
MPO Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MPO |
Myeloperoxidase (MPO) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-310 of human Myeloperoxidase (MPO) (NP_000241.1). |
Modifications | Unmodified |
USD 447.00
2 Weeks
MPO mouse monoclonal antibody, clone OTI4G10
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
2 Weeks
MPO biotinylated mouse monoclonal antibody, clone OTI4B1
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
MPO mouse monoclonal antibody, clone OTI3A11
MPO mouse monoclonal antibody, clone OTI3A11
MPO mouse monoclonal antibody, clone OTI3E7
MPO mouse monoclonal antibody, clone OTI3E7
MPO mouse monoclonal antibody, clone OTI2A11
MPO mouse monoclonal antibody, clone OTI2A11
MPO mouse monoclonal antibody, clone OTI3E10
MPO mouse monoclonal antibody, clone OTI3E10
MPO mouse monoclonal antibody, clone OTI1D3
MPO mouse monoclonal antibody, clone OTI1D3
MPO mouse monoclonal antibody, clone OTI4G10
MPO mouse monoclonal antibody, clone OTI4G10
MPO mouse monoclonal antibody, clone OTI6A9
MPO mouse monoclonal antibody, clone OTI6A9
MPO mouse monoclonal antibody, clone OTI2E1C7