Germany
Japan
United Kingdom
China
Rabbit anti-KAT7 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KAT7 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MYST2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: PRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQ |
Rabbit Polyclonal anti-MYST2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLS |
Rabbit Polyclonal Anti-MYST2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLS |
Active filters
Target Symbol
- KAT7
Isotypes
- IgG
Families
- Druggable Genome