Rabbit Polyclonal Anti-PRMT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT7 antibody: synthetic peptide directed towards the N terminal of human PRMT7. Synthetic peptide located within the following region: MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ |
Anti-PRMT7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 526-692 amino acids of human protein arginine methyltransferase 7 |
Anti-PRMT7 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 526-692 amino acids of human protein arginine methyltransferase 7 |
Germany
Japan
United Kingdom
China
