Antibodies

View as table Download

Rabbit Polyclonal Anti-UBD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen UBD antibody was raised against a 16 amino acid peptide near the center of human UBD.

Rabbit Polyclonal Anti-SLCO1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen SLCO1B1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLCO1B1.

Rabbit polyclonal anti-UBD antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human UBD

Rabbit Polyclonal Anti-UBD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBD antibody: synthetic peptide directed towards the N terminal of human UBD. Synthetic peptide located within the following region: RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE