Antibodies

View as table Download

Rabbit Polyclonal Anti-ACO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926)

Rabbit Polyclonal Anti-GRHPR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRHPR antibody: synthetic peptide directed towards the N terminal of human GRHPR. Synthetic peptide located within the following region: EPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDH

Rabbit Polyclonal Anti-MDH2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MDH2 antibody: synthetic peptide directed towards the C terminal of human MDH2. Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK

Goat Polyclonal Anti-MDH1 / MOR2 (aa211-223) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-MDH1 / MOR2 (aa211-223) Antibody: Peptide with sequence C-PDVNHAKVKLQGK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1.

Goat Polyclonal Anti-MDH1 / MOR2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-MDH1 / MOR2 Antibody: Peptide with sequence TNCLTASKSAPSIPK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1.

MDH1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Malic dehydrogenase is isolated and purified from Human erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

MDH1 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Malic dehydrogenase is isolated and purified from Human erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

MDH1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Malic dehydrogenase is isolated and purified from Human erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

MDH1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Malic dehydrogenase is isolated and purified from Human placenta.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

MDH1 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Malic dehydrogenase is isolated and purified from Human placenta.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

MDH1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Malic dehydrogenase is isolated and purified from Human placenta.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Mouse Anti-Human MDH2 Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MDH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1. Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Goat Anti-ACO1 / Aconitase 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVDFNRRADSLQKNQ, from the internal region of the protein sequence according to NP_002188.1.

Rabbit polyclonal MTHFD2 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2.

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD

Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R).
Modifications Phospho-specific

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG

Rabbit Polyclonal Anti-MTHFD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYV

MDH1 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human MDH1

MDH2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human MDH2

Goat Anti-MTHFD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RGDLNDCFIPCTPK, from the internal region of the protein sequence according to NP_005947.2.

Rabbit Polyclonal Anti-MTHFD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Rabbit Polyclonal Anti-MTHFD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the middle region of human MTHFD2. Synthetic peptide located within the following region: VWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVT

Rabbit Polyclonal Anti-MTHFD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI9G2 (formerly 9G2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI9E6 (formerly 9E6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI10A3 (formerly 10A3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ACO1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble

Anti-ACO1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble

Rabbit Polyclonal Anti-MDH1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MDH1

GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI9G2 (formerly 9G2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated