Antibodies

Jump to Filters
View as table Download
MINPP1 Rabbit Polyclonal Antibody
TA312927

USD 345.00

In Stock

Rabbit polyclonal anti-MINPP1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MINPP1.
MINPP1 Rabbit Polyclonal Antibody
TA308980

USD 415.00

5 Days

Rabbit polyclonal antibody to MIPP (multiple inositol polyphosphate histidine phosphatase, 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 246 and 487 of MIPP (Uniprot ID#Q9UNW1)
MINPP1 Rabbit Polyclonal Antibody
TA331213

USD 375.00

5 Days

Rabbit Polyclonal Anti-MINPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL
MINPP1 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF507234

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
MINPP1 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA507234

USD 379.00

In Stock

Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
MINPP1 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA507234S

USD 159.00

2 Days

Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated