Antibodies

View as table Download

Rabbit anti-AREG Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AREG

Rabbit Polyclonal Anti-AREG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AREG

Rabbit Polyclonal anti-AREG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AREG antibody: synthetic peptide directed towards the middle region of human AREG. Synthetic peptide located within the following region: PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR