Rabbit polyclonal anti-MINPP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MINPP1. |
Rabbit polyclonal anti-MINPP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MINPP1. |
Rabbit polyclonal antibody to MIPP (multiple inositol polyphosphate histidine phosphatase, 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 246 and 487 of MIPP (Uniprot ID#Q9UNW1) |
Rabbit Polyclonal Anti-MINPP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL |
Carrier-free (BSA/glycerol-free) MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |