Antibodies

View as table Download

STEAP4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STEAP4 antibody was raised against synthetic peptide from human STEAP4.

Goat Polyclonal Antibody against STEAP4 / Dudulin4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CVDNTLTRIRQGWERN, from the C Terminus of the protein sequence according to NP_078912.2.

Rabbit polyclonal STEAP4 antibody [#C11207]

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STEAP4.

Rabbit Polyclonal STEAP4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STEAP4 antibody was raised against a 14 amino acid peptide from near the center of human STEAP4.

Rabbit Polyclonal Anti-STEAP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STEAP4 antibody: synthetic peptide directed towards the C terminal of human STEAP4. Synthetic peptide located within the following region: AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA

Rabbit Polyclonal Anti-STEAP4 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen STEAP4 antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human STEAP4. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey, Marmoset (93%); Gibbon, Mouse, Bat, Horse (87%); Hamster, Elephant, Panda, Rabbit, Pig, Xenopus (80%).

Anti-STEAP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4

Anti-STEAP4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4