Antibodies

Jump to Filters
View as table Download
Apolipoprotein B (APOB) Goat Polyclonal Antibody
AP22590PU-N

USD 440.00

2 Weeks

Apolipoprotein B (APOB) goat polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
Immunogen ApoLipoprotein Type B was isolated from human plasma by density gradient centrifugation followed by HPLC purification,
Apolipoprotein B (APOB) Rabbit Polyclonal Antibody
TA346184

USD 475.00

5 Days

Rabbit Polyclonal Anti-APOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
Apolipoprotein B (APOB) Goat Polyclonal Antibody
AP22472PU-N

USD 440.00

2 Weeks

Apolipoprotein B (APOB) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Affinity purified Apolipoprotein-B (hLDL)
Apolipoprotein B (APOB) Goat Polyclonal Antibody
TA305876

USD 375.00

5 Days

Goat Anti-APOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDLHLRYQKDKK, from the internal region of the protein sequence according to NP_000375.2.
Apolipoprotein B (APOB) Rabbit Polyclonal Antibody
TA323677

USD 345.00

In Stock

Anti-APOB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen)
Apolipoprotein B (APOB) Rabbit Polyclonal Antibody
TA323678

USD 345.00

In Stock

Anti-APOB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen)