Antibodies

Jump to Filters
View as table Download
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
AP01369PU-N

USD 370.00

Please Inquire

Smad Interacting Protein 1 (ZEB2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human SIP1.
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA349437

USD 380.00

In Stock

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZEB2
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA343754

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2. Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA312721

USD 345.00

In Stock

Rabbit polyclonal anti-ZEB2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZEB2.
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA319793

USD 430.00

5 Days

Rabbit Polyclonal ZEB2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZEB2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ZEB2.
Smad Interacting Protein 1 (ZEB2) (C-term) Rabbit Polyclonal Antibody
AP31202PU-N

USD 525.00

2 Weeks

Smad Interacting Protein 1 (ZEB2) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ZEB2 antibody was raised against an 18 amino acid synthetic near the carboxy terminus of Human ZEB2.
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA347952

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 Antibody: A synthesized peptide derived from human ZEB2
Smad Interacting Protein 1 (ZEB2) (N-term) Rabbit Polyclonal Antibody
AP31272PU-N

USD 440.00

2 Weeks

Smad Interacting Protein 1 (ZEB2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
Smad Interacting Protein 1 (ZEB2) (C-term) Rabbit Polyclonal Antibody
AP54642PU-N

USD 450.00

2 Weeks

Smad Interacting Protein 1 (ZEB2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen Immunized with a KLH conjugated synthetic peptide between 1078-1105 amino acids from the C-terminal region of human ZEB2
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA334225

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZFHX1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFHX1B antibody: synthetic peptide directed towards the N terminal of human ZFHX1B. Synthetic peptide located within the following region: NVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALL
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA334226

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the N terminal of human ZEB2. Synthetic peptide located within the following region: SETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEE
Smad Interacting Protein 1 (ZEB2) Goat Polyclonal Antibody
TA311426

USD 375.00

5 Days

Goat Anti-ZEB2 (aa545-558) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDSRRQISNIKKEK, from the internal region of the protein sequence according to NP_055610.1; NP_001165124.1.
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI15G8]
CF802108

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI3D8]
CF802110

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
CF802113

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI4G3]
CF802114

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA802113

USD 379.00

In Stock

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]
TA802113AM

USD 420.00

5 Days

ZEB2 mouse monoclonal antibody,clone 1E12, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]
TA802113BM

USD 420.00

5 Days

ZEB2 mouse monoclonal antibody,clone 1E12, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA802113S

USD 159.00

In Stock

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated