Antibodies

Jump to Filters
View as table Download
Galectin 1 (LGALS1) Rabbit Polyclonal Antibody
TA344315

USD 475.00

5 Days

Rabbit Polyclonal Anti-LGALS1 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
Galectin 1 (LGALS1) Rabbit Polyclonal Antibody
TA311982

USD 345.00

In Stock

Rabbit polyclonal anti-LGALS1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human LGALS1.
Galectin 1 (LGALS1) Rabbit Polyclonal Antibody
AP51860PU-N

USD 450.00

2 Weeks

Galectin 1 (LGALS1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Gst fusion protein from Human Galectin-1
Galectin 1 (LGALS1) Mouse Monoclonal Antibody [Clone ID: OTI1E2]
CF810821

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI1E2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Galectin 1 (LGALS1) Mouse Monoclonal Antibody [Clone ID: OTI7C3]
CF810852

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI7C3

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Galectin 1 (LGALS1) Rabbit Polyclonal Antibody
TA321466

USD 345.00

4 Weeks

Anti-LGALS1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Galectin 1 (LGALS1) Rabbit Polyclonal Antibody
TA321467

USD 345.00

4 Weeks

Anti-LGALS1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Galectin 1 (LGALS1) Mouse Monoclonal Antibody [Clone ID: OTI1E2]
TA810821

USD 379.00

In Stock

LGALS1 mouse monoclonal antibody,clone OTI1E2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Galectin 1 (LGALS1) Mouse Monoclonal Antibody [Clone ID: OTI7C3]
TA810852S

USD 159.00

2 Days

LGALS1 mouse monoclonal antibody,clone OTI7C3

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".