Rabbit polyclonal NRG1 isoform-10 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NRG1 isoform-10. |
Rabbit polyclonal NRG1 isoform-10 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NRG1 isoform-10. |
NRG1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NRG1 |
Rabbit Polyclonal Anti-NRG1 isoform-10 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NRG1 isoform-10 Antibody: A synthesized peptide derived from human NRG1 isoform-10 |
NRG1 (Isoform 10) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Anti-Human Heregulinβ-1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Heregulinβ-1 |
Biotinylated Anti-Human Heregulinβ-1 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Heregulinβ-1 |
Rabbit Polyclonal Anti-NRG1 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | NRG1 / Heregulin / Neuregulin antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human NRG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-NRG1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | NRG1 / Heregulin / Neuregulin antibody was raised against synthetic 17 amino acid peptide from internal region of human NRG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon (94%); Mouse, Rat, Hamster, Elephant, Bat, Horse, Pig, Platypus (82%). |
Rabbit Polyclonal Anti-NRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the N terminal of human NRG1. Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS |
Rabbit Polyclonal Anti-NRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human NRG1. Synthetic peptide located within the following region: SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV |
Carrier-free (BSA/glycerol-free) NRG1 mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NRG1 mouse monoclonal antibody,clone OTI3B6
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NRG1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NRG1 |
Rabbit Polyclonal Anti-NRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NRG1 |
NRG1 mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NRG1 mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NRG1 mouse monoclonal antibody,clone OTI3B6
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NRG1 mouse monoclonal antibody,clone OTI3B6
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |