Antibodies

Jump to Filters
View as table Download
Snf1lk (SIK1) Rabbit Polyclonal Antibody
TA320117

USD 430.00

In Stock

Rabbit Polyclonal SIK1 Antibody

Applications IHC, WB
Reactivities Human
Immunogen SIK1 antibody was raised against an 18 amino acid synthetic peptide near the center of human SIK1.
SIK1B (1-101) Mouse Monoclonal Antibody [Clone ID: 2C12]
AM31899PU-N

USD 480.00

2 Weeks

SIK1B (1-101) mouse monoclonal antibody, clone 2C12, Purified

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Snf1lk (SIK1) Rabbit Polyclonal Antibody
TA316162

USD 345.00

4 Weeks

Rabbit polyclonal SIK (Ab-182) antibody

Applications WB
Reactivities Human, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human SIK around the phosphorylation site of threonine 182 (L-S-TP-W-C).
Snf1lk (SIK1) Rabbit Polyclonal Antibody
TA338957

USD 310.00

5 Days

Rabbit Polyclonal Anti-SNF1LK Antibody

Applications IHC, WB
Reactivities Human
Immunogen The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK. Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
Snf1lk (SIK1) Rabbit Polyclonal Antibody
TA351732

USD 345.00

In Stock

Rabbit Polyclonal Anti-SIK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIK1