Goat Polyclonal Antibody against PTF1A
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-WTDEKQLKEQN, from the internal region of the protein sequence according to NP_835455.1. |
Goat Polyclonal Antibody against PTF1A
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-WTDEKQLKEQN, from the internal region of the protein sequence according to NP_835455.1. |
Rabbit Polyclonal anti-PTF1A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV |
Rabbit Polyclonal Anti-PTF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP |
Rabbit Polyclonal Anti-Ptf1a Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG |
Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI3G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI5E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI1H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PTF1A mouse monoclonal antibody,clone OTI3G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTF1A mouse monoclonal antibody,clone OTI3G1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PTF1A mouse monoclonal antibody,clone OTI3G1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PTF1A mouse monoclonal antibody,clone OTI3G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PTF1A mouse monoclonal antibody,clone OTI5E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
PTF1A mouse monoclonal antibody,clone OTI5E5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PTF1A mouse monoclonal antibody,clone OTI5E5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PTF1A mouse monoclonal antibody,clone OTI5E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PTF1A mouse monoclonal antibody,clone OTI1H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTF1A mouse monoclonal antibody,clone OTI1H6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PTF1A mouse monoclonal antibody,clone OTI1H6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PTF1A mouse monoclonal antibody,clone OTI1H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".