Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
Rabbit Polyclonal Anti-AGTR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
Goat Polyclonal Anti-ADRA1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit Polyclonal Anti-A2B Adenosine Receptor (extracellular)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide KDSATNN*STEPWDGTTNESC, corresponding to amino acid residues 147-166 of human A2B Adenosine Receptor with replacement of cysteine 154 (C154) with serine (*S). 2nd extracellular loop. |
Goat Polyclonal Antibody against AGTR1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EIQKNKPRNDDIFK, from the internal region of the protein sequence according to NP_000676.1; NP_004826.2; NP_033611.1; NP_114038.1; NP_114438.1. |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%). |
Rabbit polyclonal EDNRA Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EDNRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 125-154 amino acids from the Central region of human EDNRA. |
Rabbit Polyclonal Anti-alpha1B-Adrenoceptor (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNANFTGPNQTSSNS, corresponding to amino acid residues 21-35 of human a1B-adrenoceptor . Extracellular, N-terminus. |
USD 450.00
2 Weeks
Rabbit anti-ADRA1D polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-ADRA1B antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRA1B. |
Prostaglandin I2 Receptor (PTGIR) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
alpha 1a Adrenergic Receptor (ADRA1A) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 206 and 270 of Human Alpha-1A adrenergic receptor |
Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%). |
Rabbit Polyclonal Anti-alpha1A-Adrenoceptor (extracellular)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide EDETI*SQINEEPG(C), corresponding to amino acid residues 171-183 of human a1A adrenoceptor with replacement of cysteine 176 (C176) with serine. 2nd extracellular loop. |
Rabbit Polyclonal Anti-ADORA2B Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B/Adenosine A2B Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human Adenosine A2b Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Horse (94%); Rabbit (88%); Dog (81%). |
AVPR1A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 354-383 amino acids from the C-terminal region of human AVPR1A |
Goat Polyclonal Antibody against AVPR1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRDLELADGEGTAE, from the C-Terminus of the protein sequence according to NP_000698.1. |
Rabbit polyclonal antibody to Adenosine A2A-R (adenosine A2a receptor)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 255 and 345 of Adenosine A2a Receptor |
Rabbit anti-ADRA1B polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Goat Anti-AVPR1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CHPLKTLQQPARRSR, from the internal region of the protein sequence according to NP_000697.1. |
Rabbit polyclonal anti-AVPR1B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AVPR1B. |
| Modifications | Phospho-specific |
AVPR1B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | AVPR1B antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human AVPR1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Mouse (94%). |
Alpha 1b / ADRA1B Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog |
| Conjugation | Unconjugated |
| Immunogen | ADRA1B antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Bovine, Dog (100%); Elephant (90%); Bat (85%); Opossum, Platypus (80%). |
Alpha 1b / ADRA1B Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | ADRA1B antibody was raised against synthetic 20 amino acid peptide from C-terminal cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Mouse, Hamster, Elephant (85%). |
Mouse monoclonal AVPR1A Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ADORA2A Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADORA2A/Adenosine A2A Receptor antibody was raised against synthetic 20 amino acid peptide from C-terminal cytoplasmic domain of human ADORA2A. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset (95%); Dog (80%). |
Rabbit Polyclonal Anti-ADRA1D Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ADRA1D antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human ADRA1D. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Dog, Panda, Horse, Pig, Guinea pig (100%); Mouse, Rat, Bovine, Hamster, Rabbit, Opossum (94%); Bat (89%). |
Rabbit Polyclonal Anti-AVPR1A Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | AVPR1A / V1a Receptor antibody was raised against synthetic 18 amino acid peptide from cytoplasmic domain of human AVPR1A. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset, Horse, Rabbit (89%); Mouse (83%). |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADORA2B antibody: synthetic peptide directed towards the C terminal of human ADORA2B. Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN |
Rabbit Polyclonal Anti-ADRA1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRA1D antibody: synthetic peptide directed towards the C terminal of human ADRA1D. Synthetic peptide located within the following region: RSLEAGVKRERGKASEVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSV |
Rabbit Polyclonal Anti-ADRA1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRA1B antibody: synthetic peptide directed towards the C terminal of human ADRA1B. Synthetic peptide located within the following region: YRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPP |
Rabbit Polyclonal Anti-ADRA1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRA1B antibody: synthetic peptide directed towards the N terminal of human ADRA1B. Synthetic peptide located within the following region: VWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAV |
Rabbit Polyclonal Anti-ADRA1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRA1A antibody is: synthetic peptide directed towards the C-terminal region of Human ADRA1A. Synthetic peptide located within the following region: LKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSRE |
Rabbit anti V1bR (pY338) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
