Rabbit polyclonal anti-GLRB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLRB. |
Rabbit polyclonal anti-GLRB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLRB. |
Anti-HTR3A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic |
Rabbit anti-GLRA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GLRA1 |
Rabbit anti-GABRR1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRR1 |
Rabbit Polyclonal Anti-GABRG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRG1 Antibody: A synthesized peptide derived from human GABRG1 |
Goat Polyclonal Antibody against Serotonin receptor 3A / HTR3A
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GPQDFEKSPRDR, from the internal region of the protein sequence according to NP_998786.1; NP_000860.1. |
Rabbit polyclonal anti-GABRA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA4. |
Rabbit polyclonal anti-CHRNA10 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CHRNA10. |
Rabbit polyclonal GABRA2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434 |
Modifications | Phospho-specific |
Rabbit Polyclonal GABA-RB Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB |
USD 375.00
5 Days
Goat Anti-CHRNB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1. |
Rabbit polyclonal anti-CHRNB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CHRNB1. |
Anti-CHRNA10 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 360-373 amino acids of human cholinergic receptor, nicotinic, alpha 10 (neuronal) |
Rabbit Polyclonal Anti-GABRD Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
USD 429.00
2 Weeks
Goat Polyclonal Anti-CHRNA7 Antibody
Reactivities | Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CHRNA7 Antibody: Peptide with sequence KRPGEDKVRPACQHKQ, from the internal region of the protein sequence according to NP_000737.1. |
USD 375.00
5 Days
Goat Polyclonal Antibody against CHRNA4 (aa29-43)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVETRAHAEERLLKK, from the internal region of the protein sequence according to NP_000735.1. |
Goat Polyclonal Antibody against CHRNB3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRHVKKEHFISQ, from the internal region of the protein sequence according to NP_000740.1. |
Goat Anti-CHRNB1 / ACHRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QEQEDHDALKED, from the internal region of the protein sequence according to NP_000738.2. |
Rabbit polyclonal anti-GABRA6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA6. |
Rabbit polyclonal anti-GABRG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRG1. |
Anti-GABRB1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.432~436 (R-A-S-Q-L) derived from Human GABRB1. |
Anti-Gabra3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 33~37(R-R-Q-E-P)derived from Rat GABA A Receptor a3. |
Rabbit Polyclonal Anti-CHRNA3 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA3 antibody: synthetic peptide directed towards the N terminal of human CHRNA3. Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CHRNA7 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7. Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV |
Rabbit Polyclonal Anti-Gabra3 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Gabra3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gabra3. Synthetic peptide located within the following region: LLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIF |
Rabbit Polyclonal Anti-Htr3a Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Htr3a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH |
Anti-GLRA1/GLRA2/GLRA3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human glycine receptor, alpha 1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Anti-CHRNA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 69-83 amino acids of Human cholinergic receptor, nicotinic, alpha 3 (neuronal) |
Anti-CHRNA10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 360-373 amino acids of human cholinergic receptor, nicotinic, alpha 10 (neuronal) |
Anti-GABRR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of Human gamma-aminobutyric acid (GABA) A receptor, rho 1 |
Anti-HTR3A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic |
Rabbit Polyclonal Anti-GABRB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABRB1 |
Rabbit Polyclonal Anti-GAMT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GLRA1 |
Rabbit Polyclonal Anti-CHRNA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHRNA1 |
Rabbit Polyclonal Anti-GABRA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABRA1 |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABRG2 |