Antibodies

View as table Download

Rabbit polyclonal anti-KCNMB2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KCNMB2.

KCNMB1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 42-72 amino acids from the Central region of human KCNMB1

Rabbit Polyclonal Anti-slobeta2 (KCNMB2)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RHDEKRNIYQKIRDHDLLD, corresponding to amino acid residues 14-32 of human sloÃ?2.Intracellular, N-terminal part.

KCNMB1 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

KCNMB3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Gorilla
Immunogen KCNMB3 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (87%); Marmoset (80%).

KCNMB3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Immunogen KCNMB3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Bovine, Bat, Horse (88%); Gibbon, Dog, Pig (82%).

Mouse monoclonal BK Beta3a Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal Anti-BK Beta2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal Anti-BKBeta4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC

Rabbit Polyclonal Anti-KCNMB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KCNMB2 antibody is: synthetic peptide directed towards the C-terminal region of Human KCNMB2. Synthetic peptide located within the following region: QKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTK

Rabbit Polyclonal Anti-KCNMB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB1

Rabbit Polyclonal Anti-KCNMB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB2

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB3

Rabbit Polyclonal Anti-KCNMB4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB4

KCNMB4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4