Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit anti-PPP1CB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CB |
Mouse anti pTEN Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PPP1CB (Clone EP1804Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit anti-PPP1CA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CA |
Rabbit polyclonal PTEN (Ab-370) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370. |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
Modifications | Phospho-specific |
Rabbit Polyclonal PTEN Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Mouse Monoclonal PPP1A Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit. |
PP1C gamma (PPP1CC) sheep polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |
PPP1A (PPP1CA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal PTEN Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PTEN antibody was raised against a 15 amino acid peptide from near the amino terminus of human PTEN. |
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse and Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB). |
Mouse Monoclonal PPP1A Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti pTEN(pS380) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -DTSDP-- with phosphorylation sites at Ser385 of PTEN protein from human, mouse and rat origins. |
Rabbit anti pTEN Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human PTEN protein. This sequence is identical among human, mouse, rat origins. |
Rabbit anti pTEN (Paired S380) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -DTSDP—without a phosphorylation site at Ser385 of human PTEN protein. This sequence is identical among human, mouse, rat , bovine and chicken origins. |
PP1C gamma (PPP1CC) (Isoform gamma-2) sheep polyclonal antibody, Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Purified peptide conjugated to KLH corresponding to the sequence NH2-Gln-Lys-Ala-Ser-Asn-Tyr-Arg-Asn-Asn-Thr-Val-Lys-Tyr-Glu-COOH. |
Rabbit Polyclonal PTEN Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PTEN antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human PTEN. |
Rabbit polyclonal anti-PTEN-P1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to amino acids near the N-terminal end of human PTEN-P1 protein. |
Anti-PPP1CA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-PPP1CB Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP |
Rabbit Polyclonal Anti-PPP1CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: VPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLI |
Rabbit Polyclonal Anti-PPP1CA Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ppp1ca antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca. Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS |
Mouse Monoclonal PP1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PPP1CB Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Anti-PPP1CB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Anti-PTEN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 381-396 amino acids of human phosphatase and tensin homolog |
Rabbit Polyclonal Anti-PPP1CC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PPP1CC |
PPP1CC Antibody - C-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Reactivities | Human |
PTEN mouse monoclonal antibody,clone 1C3, Biotinylated
Reactivities | Human |
Conjugation | Biotin |
PTEN mouse monoclonal antibody,clone 1C3, HRP conjugated
Reactivities | Human |
Conjugation | HRP |
PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Reactivities | Human |
Conjugation | Unconjugated |
PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
Reactivities | Human |
PTEN mouse monoclonal antibody,clone 2H9, Biotinylated
Reactivities | Human |
Conjugation | Biotin |
PTEN mouse monoclonal antibody,clone 2H9, HRP conjugated
Reactivities | Human |
Conjugation | HRP |
PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
Reactivities | Human |
Conjugation | Unconjugated |
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |