Rabbit anti-PPP1CB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CB |
Rabbit anti-PPP1CB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CB |
Rabbit Polyclonal Anti-INPP5K Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PPP1CB (Clone EP1804Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit anti-PPP1CA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CA |
Rabbit Polyclonal PTPN1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment |
Rabbit Polyclonal PTP1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B |
Rabbit Polyclonal Phospho-PTP1B (Ser50) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B around the phosphorylation site of Serine 50 |
Modifications | Phospho-specific |
Mouse Monoclonal PPP1A Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit. |
PP1C gamma (PPP1CC) sheep polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |
PPP1A (PPP1CA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal PPP1R3A Antibody (Center)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PPP1R3A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 754-782 amino acids from the Central region of human PPP1R3A. |
Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB). |
Mouse Monoclonal PPP1A Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PP1C gamma (PPP1CC) (Isoform gamma-2) sheep polyclonal antibody, Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Purified peptide conjugated to KLH corresponding to the sequence NH2-Gln-Lys-Ala-Ser-Asn-Tyr-Arg-Asn-Asn-Thr-Val-Lys-Tyr-Glu-COOH. |
Anti-PPP1CA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-PPP1CB Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP |
Rabbit Polyclonal Anti-PPP1CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: VPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLI |
Rabbit Polyclonal Anti-PPP1CA Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ppp1ca antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca. Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS |
Mouse Monoclonal PP1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PPP1CB Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Anti-PPP1CB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Rabbit Polyclonal Anti-PPP1CC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PPP1CC |
PPP1R3A Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1R3A |
INPP5K Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PPP1R3B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PPP1CC Antibody - C-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |