Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 22 of 22 results

(reset)

PPP4C Rabbit Polyclonal Antibody

TA327274

USD 275.00

3 Weeks

PPP4C Rabbit Polyclonal Antibody

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PPP4C

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PPP4C Rabbit Polyclonal Antibody

TA344304

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP4C Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PPP4C antibody: synthetic peptide directed towards the middle region of human PPP4C. Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

PPP4C (290-301) Goat Polyclonal Antibody

AP22586PU-N

USD 440.00

2 Weeks

PPP4C (290-301) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish
Immunogen	synthetic peptide from the C-terminus of human PPP4C (NP_002711.1)

1 / 3

2 / 3

3 / 3

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: 2F11-D10-G4]

TA347025

USD 380.00

4 Weeks

Mouse Monoclonal Protein Phosphatase 4C Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

PPP4C Rabbit Polyclonal Antibody

AP05056PU-N

USD 360.00

5 Days

PPP4C rabbit polyclonal antibody, Purified

Applications	IHC, WB
Reactivities	Bovine, Human, Mouse, Rat
Immunogen	A PP X/C peptide conjugated to KLH

PPP4C Sheep Polyclonal Antibody

AP05057PU-N

USD 360.00

5 Days

PPP4C sheep polyclonal antibody, Purified

Applications	IHC, WB
Reactivities	Bovine, Human, Mouse, Rat
Immunogen	A PP X/C peptide conjugated to KLH

PPP4C Goat Polyclonal Antibody

TA305920

USD 375.00

5 Days

Goat Anti-PPP4C Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-PQETRGIPSKKP, from the C-Terminus of the protein sequence according to NP_002711.1.

1 / 2

2 / 2

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H8]

CF810212

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2H8

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF810213

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2E4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H7]

CF810219

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2H7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H8]

TA810212

USD 379.00

In Stock

PPP4C mouse monoclonal antibody,clone OTI2H8

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PPP4C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H8]

TA810212AM

USD 420.00

4 Weeks

PPP4C mouse monoclonal antibody,clone OTI2H8, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PPP4C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H8]

TA810212BM

USD 420.00

4 Weeks

PPP4C mouse monoclonal antibody,clone OTI2H8, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H8]

TA810212S

USD 159.00

2 Days

PPP4C mouse monoclonal antibody,clone OTI2H8

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA810213

USD 379.00

In Stock

PPP4C mouse monoclonal antibody,clone OTI2E4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

PPP4C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

TA810213AM

USD 420.00

4 Weeks

PPP4C mouse monoclonal antibody,clone OTI2E4, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

PPP4C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E4]

TA810213BM

USD 420.00

4 Weeks

PPP4C mouse monoclonal antibody,clone OTI2E4, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA810213S

USD 159.00

2 Days

PPP4C mouse monoclonal antibody,clone OTI2E4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H7]

TA810219

USD 379.00

In Stock

PPP4C mouse monoclonal antibody,clone OTI2H7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPP4C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H7]

TA810219AM

USD 420.00

4 Weeks

PPP4C mouse monoclonal antibody,clone OTI2H7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPP4C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H7]

TA810219BM

USD 420.00

4 Weeks

PPP4C mouse monoclonal antibody,clone OTI2H7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H7]

TA810219S

USD 159.00

2 Days

PPP4C mouse monoclonal antibody,clone OTI2H7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 22 of 22 results