USD 420.00
In Stock
LIPG mouse monoclonal antibody, clone 9C5, Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
In Stock
LIPG mouse monoclonal antibody, clone 9C5, Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Biotin |
Rabbit anti-LIPC Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIPC |
LIPC (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 310-338 amino acids from the Central region of Human LIPC / Hepatic lipase |
Rabbit Polyclonal Anti-LIPF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH |
Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233) |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ |
LIPC (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 16-44 amino acids from the N-terminal region of Human LIPC / Hepatic lipase |
Rabbit Polyclonal Antibody against Endothelial Lipase
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the human endothelial lipase protein sequence. |
Rabbit Polyclonal Antibody against Endothelial Lipase
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | An N-terminal synthetic peptide made to the human endothelial lipase protein sequence. |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV |
Pancreatic Lipase (PNLIP) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 311-341 amino acids from the C-terminal region of human Pancreatic lipase / PNLIP |
Goat Anti-Endothelial lipase Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RFNLRTSKDPEHEG, from the internal region of the protein sequence according to NP_006024.1. |
Anti-LIPC Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 220 amino acids of human lipase, hepatic |
Rabbit Polyclonal Anti-LIPC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9F2 (formerly 9F2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | FC, IF, IHC, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8E4 (formerly 8E4)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7D1 (formerly 7D1)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6B11 (formerly 6B11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PNLIP mouse monoclonal antibody,clone OTI9A9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PNLIP mouse monoclonal antibody,clone OTI5B9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PNLIP |
LIPC Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LIPG mouse monoclonal antibody, clone 9C5, HRP conjugated
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | HRP |
LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LIPG mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LIPG mouse monoclonal antibody, clone 6B9, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
LIPG mouse monoclonal antibody, clone 6B9, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |