Antibodies

View as table Download

Rabbit anti-GRN Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRN

Goat Anti-Granulin / GRN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QSKCLSKENATTD, from the internal region of the protein sequence according to NP_002078.1.

Rabbit polyclonal GRN Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GRN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 563-591 amino acids from the C-terminal region of human GRN.

Rabbit Polyclonal Anti-GRN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRN antibody is: synthetic peptide directed towards the middle region of Human GRN. Synthetic peptide located within the following region: CPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD

Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI3H6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody,clone OTI2D1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GRN mouse monoclonal antibody, clone OTI3H6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GRN mouse monoclonal antibody, clone OTI3H6, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

GRN mouse monoclonal antibody, clone OTI3H6, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

GRN mouse monoclonal antibody, clone OTI3H6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC
Reactivities Human
Conjugation Unconjugated

GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3), Biotinylated

Applications IHC
Reactivities Human
Conjugation Biotin

GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3), HRP conjugated

Applications IHC
Reactivities Human
Conjugation HRP

GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GRN mouse monoclonal antibody,clone OTI2D1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GRN mouse monoclonal antibody,clone OTI2D1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".