Rabbit Polyclonal p53 (Ser15) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 15 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
p53 (TP53) pSer392 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Monkey, Rat |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within p53 which includes phosphorylated Ser392. |
Cyclin D1 (CCND1) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CCND1 |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
p53 (TP53) pSer37 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
Cyclin D1 (CCND1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human Cyclin D1 |
Rabbit polyclonal Cyclin D1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Cyclin D1 was produced by repeated immunizations of full length fusion protein corresponding to the human gene sequence. |
Rabbit polyclonal CCND1 Antibody (C-term T288)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCND1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 267-294 amino acids from the C-terminal region of human CCND1. |
Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human p53 around the phosphorylation site of Sersine 46. |
| Modifications | Phospho-specific |
Mouse monoclonal anti-TP53 antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-cyclin D1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TRFLSRVIKCDPD, from the internal region of the protein sequence according to NP_444284.1 |
Rabbit Polyclonal Anti-TRP53 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRP53 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR |
Rabbit Polyclonal p53K372me1 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-p53K372me1 antibody: human p53 (tumor protein p53), methylated at K372, using a KLH-conjugated synthetic peptide. |
Mouse monoclonal Anti-p53 Clone Pab 1801
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-p53 Clone Pab DO-1
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti Cyclin D1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat. |
Mouse anti p53 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
