Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIM32 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY

Anti-TRIM32 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human tripartite motif containing 32

Rabbit Polyclonal anti-TRIM32 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE

Rabbit Polyclonal Anti-TRIM32 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK

Rabbit polyclonal antibody to TRIM32 (tripartite motif-containing 32)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 289 of TRIM32 (Uniprot ID#Q13049)

Anti-TRIM32 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human tripartite motif containing 32