Rabbit polyclonal anti-ATF1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF1. |
Rabbit polyclonal anti-ATF1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF1. |
ATF1 mouse monoclonal antibody, clone 3E7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal ATF1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ATF1 |
Rabbit Polyclonal ATF1 (Ser63) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ATF1 around the phosphorylation site of Serine 63 |
Modifications | Phospho-specific |
ATF1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide, corresponding to amino acids 20-70 of Human ATF1. |
Rabbit Polyclonal anti-ATF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ATF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF1. Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ |
Rabbit Polyclonal anti-ATF1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the middle region of human ATF1. Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR |
Rabbit Polyclonal Anti-ATF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the N terminal of human ATF1. Synthetic peptide located within the following region: ETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR |
Rabbit Polyclonal Anti-ATF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the C terminal of human ATF1. Synthetic peptide located within the following region: KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV |
Mouse monoclonal Anti-ATF1 Clone ATF1 2A9/8
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ATF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATF1 |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".