Rabbit polyclonal PID/MTA2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PID/MTA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-544 amino acids from the C-terminal region of human PID/MTA2. |
Rabbit Polyclonal PID Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PID antibody was raised against a synthetic peptide corresponding to amino acids 652 to 668 of human PID (6), which differ from the mouse sequence by one amino acid (7) . |
Rabbit Polyclonal Anti-MTA2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTA2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRP |
Rabbit Polyclonal Anti-Mta2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mta2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV |
Rabbit anti PKC (pS345) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -EDR-S-KSAP- with a phosphorylated Ser 345 of human PKC. |
Rabbit anti PID/MTA2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human p38 protein |
Germany
Japan
United Kingdom
China
