Rabbit monoclonal anti-IASPP antibody for SISCAPA, clone OTIR1G11
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-IASPP antibody for SISCAPA, clone OTIR1G11
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PPP1R13L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: GLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHG |
Rabbit polyclonal anti-iASSP antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 780-797 of human iASPP (isoform 1) protein. |
Rabbit Polyclonal Anti-PPP1R13L Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL |
Rabbit Polyclonal Anti-PPP1R13L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the C terminal of human PPP1R13L. Synthetic peptide located within the following region: EGPPKPPTELEPEPEIEGLLTPVLEAGDVDEGPVARPLSPTRLQPALPPE |
Anti-PPP1R13L Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 781-797 amino acids of Human protein phosphatase 1, regulatory subunit 13 like |