Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-Phospho-PLB(T17) Antibody
| Applications | Dot |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The PLB Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T17 of human PLB. |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-NOM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOM1. |
Rabbit polyclonal anti-TGF beta2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Rabbit polyclonal anti-TGF beta3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit anti-ITGB5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB5 |
Rabbit anti-ITGA2B Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGA2B |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Rabbit Polyclonal Anti-Integrin beta-5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin beta-5 Antibody: A synthesized peptide derived from human Integrin beta-5 |
Rabbit Polyclonal Anti-Integrin aV Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV |
Rabbit Polyclonal Anti-Integrin a3 (CD49c) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a3 (CD49c) Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-Integrin β1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1 |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal ITGA6 (light chain, Cleaved-Glu942) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGA6. |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGA5 (heavy chain, Cleaved-Phe42) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGA5. |
Rabbit polyclonal Integrin beta1 (Ab-789) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Rabbit polyclonal anti-ADCY5/ADCY6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306). |
Rabbit polyclonal anti-ADRB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB1 . |
Rabbit polyclonal ITGA7 (light chain, Cleaved-Glu959) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Integrin alpha-7 light chain. |
Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGAV. |
Rabbit polyclonal anti-RyR2 (Ser2808) antibody (Phospho-specific)
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific phosphopeptide. The antibody against non-phosphopeptide was removed by chromatography using non-phosphopeptide corresponding to the phosphorylation site. |
| Modifications | Phospho-specific |
ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%). |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit Polyclonal Integrin alpha4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin alpha4 |
Active filters
Isotypes
- IgG
Families
- Transmembrane
Pathways
- Dilated cardiomyopathy
Filter by
Category
Target Symbol
- ITGB3 (11)
- TNF (10)
- ITGAV (8)
- TGFB2 (7)
- ITGA4 (6)
- ITGB1 (6)
- ITGA6 (5)
- ADRB1 (4)
- CACNG1 (4)
- ITGA5 (4)
- ITGB5 (4)
- ADCY1 (3)
- ADCY4 (3)
- ADCY5 (3)
- ADCY6 (3)
- CACNG6 (3)
- EMD (3)
- ITGA2B (3)
- ITGA7 (3)
- ADCY2 (2)
- CACNA1C (2)
- CACNG4 (2)
- ITGA2 (2)
- ITGA3 (2)
- PLN (2)
- SGCA (2)
- SGCB (2)
- SGCG (2)
- TGFB3 (2)
- ADCY3 (1)
- ADCY7 (1)
- ADCY8 (1)
- ADCY9 (1)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNG3 (1)
- CACNG5 (1)
- CACNG7 (1)
- DAG1 (1)
- ITGA11 (1)
- ITGA8 (1)
- ITGB6 (1)
- ITGB7 (1)
- RYR2 (1)
- SGCD (1)
- SLC8A1 (1)