Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Goat Polyclonal Antibody against ABCC8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Rabbit Polyclonal Anti-SLC2A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2. Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST |
Rabbit anti-KCNJ11 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KCNJ11 |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Goat Polyclonal Anti-INSR Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 1310 aa to the C-terminus of human INSR produced in E. coli. |
Goat Polyclonal Antibody against Kcnj11 (Near N-terminal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ERRARFVSKKGNC, from the internal region (near the N Terminus) of the protein sequence according to NP_034732.1. |
Rabbit polyclonal INSR (Ab-1375) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Stathmin around the phosphorylation site of threonine 1375 (I-L-TP-L-P). |
Rabbit polyclonal INSR (Thr1375) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human INSR around the phosphorylation site of threonine 1375 (I-L-TP-L-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IR |
Rabbit Polyclonal IR (Tyr1355) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human:Y1355 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IR around the phosphorylation site of Tyrosine 1355 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IR Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IR |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Anti-ABCC8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW |
Rabbit Polyclonal IR (Tyr1361) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IR around the phosphorylation site of Tyrosine 1361 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against KCNJ11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEDPAKPRYRARQ, from the internal region (near the N Terminus) of the protein sequence according to NP_000516.3. |
Rabbit Polyclonal Anti-SLC2A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4 Antibody: synthetic peptide directed towards the N terminal of human SLC2A4. Synthetic peptide located within the following region: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV |
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KCNJ11 antibody is: synthetic peptide directed towards the middle region of HUMAN KCNJ11. Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNJ11 |
Rabbit Polyclonal Anti-SLC2A2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC2A2 |
Rabbit Polyclonal Anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CACNA1C |
Rabbit Polyclonal Anti-CACNA1A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CACNA1A |
Active filters
Isotypes
- IgG
Families
- Transmembrane
Pathways
- Type II diabetes mellitus