Rabbit Polyclonal Anti-ITGB3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB3 |
Rabbit Polyclonal Anti-ITGB3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB3 |
Rabbit Polyclonal Anti-ITGB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB1 |
Mouse Monoclonal anti-CACNA1C Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal anti-CACNA1D Antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
ITGAV Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ITGAV |
Rabbit Polyclonal TGFβ3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3. |
Rabbit polyclonal Anti-Ryanodine Receptor 2
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CAGESMSPGQGRNN, corresponding to amino acid residues 1489-1502 of human Ryanodine Receptor 2. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit polyclonal Integrin Beta5 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Integrin β5. |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-TGF beta2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Rabbit polyclonal anti-TGF beta3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit anti-ITGB5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ITGB5 |
Rabbit Polyclonal Anti-Integrin beta-5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin beta-5 Antibody: A synthesized peptide derived from human Integrin beta-5 |
Rabbit Polyclonal Anti-ACE1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1 |
Rabbit Polyclonal Anti-Integrin β1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1 |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit Polyclonal Emerin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Emerin antibody was raised against a 19 amino acid peptide from near the amino terminus of human Emerin. |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal Integrin beta1 (Ab-789) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
Modifications | Phospho-specific |
Rabbit Polyclonal TNFA Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Anti-human CaV1.2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human Cav1.2 (exon 1B). Intracellular, N-terminus. |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit polyclonal antibody to CACNG5 (calcium channel, voltage-dependent, gamma subunit 5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 43 and 246 of CACNG5 (Uniprot ID#Q9UF02) |
Rabbit polyclonal ITGB1 (Tyr795) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB1 around the phosphorylation site of tyrosine 795 (P-K-YP-E-G). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CACNG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal anti-TGF-beta2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 366 of human TGF-β2 |
Rabbit Polyclonal Integrin beta3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 |
Goat Anti-SERCA2 / ATP2A2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DELNPSAQRDACLN, from the internal region of the protein sequence according to NP_001672.1; NP_733765.1. |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Rabbit Polyclonal Anti-Cacng1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human Integrin alpha 4. |
Goat Anti-Delta-Sarcoglycan (aa245-257) Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RLPHGSYTPTGTR, from the internal region of the protein sequence according to NP_000328.2; NP_758447.1; NP_001121681.1. |
Goat Anti-DAG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVGKHEYFMHATDK, from the internal region of the protein sequence according to NP_004384.3. |
Rabbit polyclonal anti-CACNG7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Rabbit polyclonal anti-TGF-beta2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human TGF-β2 |
Anti-ATP2A2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 111-253 amino acids of human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 |
Anti-ITGAV Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1021-1034 amino acids of human integrin, alpha V |
Mouse monoclonal Anti-Integrin b3 Clone F11
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin b3 Clone MHF4
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit anti TGF-beta 2 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein. |
Carrier-free (glycerol/BSA-free) ITGB6 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ITGB1 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ITGB1 mouse monoclonal antibody,clone OTI9B5
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SGCD mouse monoclonal antibody,clone OTI3D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |