Antibodies

View as table Download

purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4D1

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700448

Rabbit Polyclonal Antibody against Carbonic Anhydrase IX

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen A synthetic peptide derived from a C-terminal sequence of the human CA IX.

Rabbit Polyclonal Anti-CA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA4 antibody: synthetic peptide directed towards the middle region of human CA4. Synthetic peptide located within the following region: DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF

Rabbit Polyclonal Anti-CA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA4 antibody: synthetic peptide directed towards the C terminal of human CA4. Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG

purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A6

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700448

purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F1

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700449

purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4G3

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700450

Rabbit polyclonal anti-CA14 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA14.

Anti-CA14 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV

Rabbit Polyclonal Carbonic Anhydrase IX Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region

Goat Anti-carbonic anhydrase XII (aa188-199) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SHLQHVKYKGQE, from the internal region of the protein sequence according to NP_001209.1; NP_996808.1.

Carbonic Anhydrase IX (CA9) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CA9

Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-CA14 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV

Anti-CA4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4

Anti-CA4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4

CA12 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CA12 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated