Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-ATP2A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Rabbit Polyclonal Anti-TAAR6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA |
Rabbit Polyclonal Anti-KCNN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
Rabbit Polyclonal Anti-KCNN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA |
Rabbit polyclonal anti-Wnt1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein. |
Mouse monoclonal anti-LGR4 antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Human, Macaque |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNN2 Antibody
| Applications | WB |
| Reactivities | Human, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2. Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ |
Germany
Japan
United Kingdom
China
