Antibodies

Jump to Filters
View as table Download
HEPC (HAMP) Rabbit Polyclonal Antibody
TA346137

USD 475.00

5 Days

Rabbit Polyclonal Anti-HAMP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAMP antibody: synthetic peptide directed towards the N terminal of human HAMP. Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
HEPC (HAMP) (Center) Rabbit Polyclonal Antibody
AP51998PU-N

USD 450.00

2 Weeks

HEPC (HAMP) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24~54 amino acids from the Central region of Human Hepcidin / HAMP