Rabbit Polyclonal Anti-CSNK1E Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH |
Rabbit Polyclonal Anti-CSNK1G3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK1G3 antibody: synthetic peptide directed towards the middle region of human CSNK1G3. Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP |
Rabbit Polyclonal Anti-CSNK1A1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD |
Rabbit Polyclonal Anti-WNT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG |
Rabbit polyclonal Anti-PRKX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD |
Rabbit Polyclonal Anti-DHH Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL |
Rabbit anti Glycogen Synthase Kinase 3b (GSK3b) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti GSK3b(Paired S9) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -TTSFA- without phosphorylation of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species |
Rabbit anti GSK3b(pS9) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -TTSFA- with a phosphorylation site at Ser9 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species. |
Rabbit anti GSK-3b (pY216) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -NVSYI- with a phosphorylation site at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species. |
Rabbit anti GSK-3b (Paired Y216) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -NVSYI- without phosphorylation at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species |
Rabbit anti GSK-3b Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of GSK-3beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species. |
Anti-WNT9A Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A |
Anti-SMO Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 772-787 amino acids of human smoothened, frizzled family receptor |
Anti-LRP2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 4640-4054 amino acids of Human low density lipoprotein receptor-related protein 2 |
Anti-LRP2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 4642-4654 amino acids of Human low density lipoprotein receptor-related protein 2 |
Anti-PRKACG Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma |
Anti-GSK3B Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 396-408 amino acids of Human glycogen synthase kinase 3 beta |
Anti-CSNK1A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 316-329 amino acids of Human Casein kinase I isoform alpha |
Anti-BMP4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Anti-SHH Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog |
Anti-GSK3B (Phospho-Tyr216) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 216 (V-S-Y(p)-I-C) derived from Human GSK3β. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CSNK1E Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CSNK1E |
Rabbit Polyclonal Anti-WNT3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WNT3A |
Rabbit Polyclonal Anti-BMP6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BMP6 |
Rabbit Polyclonal Anti-DHH Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DHH |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT2 |
Rabbit Polyclonal Anti-WNT8A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT8A |
Rabbit Polyclonal Anti-WNT10A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT10A |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-BMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP2 |
Rabbit polyclonal anti-BMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP2 |
Germany
Japan
United Kingdom
China
