Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR |
Myeloperoxidase (MPO) rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Purified human granulocytic MPO |
Myeloperoxidase (MPO) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Native human Myeloperoxidase purified from human Neutrophils |
Rabbit polyclonal anti-Myeloperoxidase (MPO) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 765 of human MPO |
Rabbit polyclonal Myeloperoxidase antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Myeloperoxidase [Human Leukocytes] |
Myeloperoxidase (MPO) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-310 of human Myeloperoxidase (MPO) (NP_000241.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MPO
Isotypes
- IgG