Rabbit anti-E2F6 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human E2F6 |
Rabbit anti-E2F6 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human E2F6 |
Rabbit Polyclonal Anti-E2F6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F6 Antibody: A synthesized peptide derived from human E2F6 |
Anti-E2F6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-E2F6 Antibody
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL |