Rabbit polyclonal anti-AIFM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIFM1. |
Rabbit polyclonal anti-AIFM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIFM1. |
Rabbit Polyclonal Anti-PDCD8 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the C terminal of human PDCD8. Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST |
Goat Polyclonal Anti-Aurora Kinase B Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Aurora Kinase B Antibody: Peptide with sequence YKELQKSCTFDEQ, from the internal region of the protein sequence according to NP_004208.2. |
Rabbit anti-AIFM1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AIFM1 |
Rabbit Polyclonal AIF Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | AIF antibody was raised against a peptide corresponding to amino acids near the amino terminus of mature human AIF. The immunogen is located within amino acids 90 - 140 of AIF. |
Rabbit Polyclonal AIF Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AIF antibody was raised against a peptide corresponding to amino acids 517 to 531 of human AIF. This sequence is identical to those of mouse and rat AIF. |
Rabbit Polyclonal Anti-AIFM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the N terminal of human PDCD8. Synthetic peptide located within the following region: GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPS |
Rabbit Polyclonal Anti-AIFM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AIFM1 antibody: synthetic peptide directed towards the middle region of human AIFM1. Synthetic peptide located within the following region: VIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED |
Anti-AIFM1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1 |
Anti-AIFM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1 |